Home > Product > Antimicrobial Peptides > Esculentin-1-RA8 peptide precursor

Antimicrobial Peptides

Esculentin-1-RA8 peptide precursor

[Price Inquiry]
CAT#
AF3161
Sequence
PLKKPLLLIVLFGIISLSLCEQERAADEDEGSEIKRGLFSKFAGK
Host Chemicals
Odorrana andersonii (golden crossband frog)
Length
45
Activity
Antimicrobial
SwissProt ID
E3SYM1
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.