Home > Product > Antimicrobial Peptides > Esculentin-1-RA8 peptide precursor

Antimicrobial Peptides

Esculentin-1-RA8 peptide precursor

Price Inquiry
CAT#
AF3161
Sequence
PLKKPLLLIVLFGIISLSLCEQERAADEDEGSEIKRGLFSKFAGK
Host Chemicals
Odorrana andersonii (golden crossband frog)
Length
45
Activity
Antimicrobial
SwissProt ID
E3SYM1

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.