CAT# | AF3072 |
Sequence | DKLIGSCVWGAVNYTSNCNAECKRRGYKGGHCGSFLNVNCWCET |
Activity | Antifungal |
Host Chemicals | Synthetic construct | Length | 44 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF704 | Uperin-2.3 | Inquiry | ||
AF2114 | Brevinin-2-RA13 peptide precursor | Inquiry | ||
AF132 | Halictine 1 | Inquiry | ||
AF1984 | Antibacterial 6.5 kDa protein | Inquiry | ||
AF3343 | CAP-18, rabbit | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Caprooyl tetrapeptide-3, an anti-wrinkle peptide, a reaction product of caproic acid and tetrapeptide-3, compris ...
Acetyl pepstatin, nature products of yeast fermentation, is general inhibitors of the family of aspartic proteas ...
ClC-2 chloride channels are voltage-gated ion channels that are expressed in neuronal and epithelial cells wher ...
NoxA1ds is derived from a peptide whose structure is based on a short sequence of an essential Nox subunit. It b ...
5. Synthetic Peptides Targeting CD36 Attenuate Lipopolysaccharide-Induced InflammationSynthetic amphipathic helical peptides ...