Home > Product > Antimicrobial Peptides > ETD154

Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF3077
Sequence
DKLIGSCVWLAVNYTSNCNAECKRRGYKGGHCGSFLNVNCWCET
Host Chemicals
Synthetic construct
Length
44
Activity
Antifungal
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.