Home > Product > Antimicrobial Peptides > Eurocin

Antimicrobial Peptides

CAT#
AF2936
Sequence
GFGCPGDAYQCSEHCRALGGGRTGGYCAGPWYLGHPTCTCSF
Host Chemicals
Aspergillus amstelodami
Length
42
Activity
Antimicrobial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.