Home > Product > Catalog Peptides > Others > Exendin (9-39)

Others

Exendin (9-39)

[Price Inquiry]
CAT#
E10001
Sequence
DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
M.W/Mr.
3369.8
Molecular Formula
C149H234N40O47S1
Length
31
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.