Home > Product > Antimicrobial Peptides > Fa-AMP2

Antimicrobial Peptides

CAT#
AF2805
Sequence
AQCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSNCR
Host Chemicals
Fagopyrum esculentum
Length
40
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.