Home > Product > Antimicrobial Peptides > Fabatin-1

Antimicrobial Peptides

CAT#
AF3226
Sequence
LLGRCKVKSNRFHGPCLTDTHCSTVCRGEGYKGGDCHGLRRRCMCLC
Host Chemicals
Broad bean, Vicia faba
Length
47
Activity
Gram+ & Gram-,
SwissProt ID
SwissProt ID: P81456
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.