Home > Product > Antimicrobial Peptides > Fabatin-2

Antimicrobial Peptides

Fabatin-2

Price Inquiry
CAT#
AF3227
Sequence
LLGRCKVKSNRFNGPCLTDTHCSTVCRGEGYKGGDCHGLRRRCMCLC
Host Chemicals
Broad bean, Vicia faba
Length
47
Activity
Gram+ & Gram-,
SwissProt ID
SwissProt ID: P81457

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.