Home > Product > Antimicrobial Peptides > Fabatin-2

Antimicrobial Peptides

CAT#
AF3227
Sequence
LLGRCKVKSNRFNGPCLTDTHCSTVCRGEGYKGGDCHGLRRRCMCLC
Host Chemicals
Broad bean, Vicia faba
Length
47
Activity
Gram+ & Gram-,
SwissProt ID
SwissProt ID: P81457
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.