Home > Product > Antimicrobial Peptides > FALL-39

Antimicrobial Peptides

CAT#
AF2766
Sequence
FALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Host Chemicals
Homo sapiens
Length
39
Activity
Antibacterial
SwissProt ID
P49913
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.