Home > Product > Catalog Peptides > Others > FDC-SP (30-85), human

Others

FDC-SP (30-85), human

[Price Inquiry]
CAT#
F01001
Sequence
SISDSDELASGFFVFPYPYPFRPLPPIPFPRFPWFRRNFPIP
M.W/Mr.
6464.3
Length
42
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.