Home > Product > Catalog Peptides > Others > Fibronectin-Binding Protein

Others

Fibronectin-Binding Protein

[Price Inquiry]
CAT#
F02040
Sequence
FNKHTEIIEEDTNKDKPSYQFGGHNSVDFEEDTLPKV
M.W/Mr.
4309.7
Molecular Formula
C190H283N49O66
Length
37
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.