Home > Product > Catalog Peptides > Others > Fibronectin Binding Protein Peptide, D3 Peptide

Others

Fibronectin Binding Protein Peptide, D3 Peptide

[Price Inquiry]
CAT#
F02041
Sequence
FNKHTEIIEEDTNKDKPSYQFGGHNSVDFEEDTLPKV
M.W/Mr.
4310.6
Length
37
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.