CAT# | F02041 |
M.W/Mr. | 4310.6 |
Sequence | FNKHTEIIEEDTNKDKPSYQFGGHNSVDFEEDTLPKV |
Length | 37 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
F02032 | Fibronectin (1946-1960), FN-C/H2 | Inquiry | ||
F02016 | Fibronectin (1951-1960), FN-C/H2-CO | Inquiry | ||
F02031 | [Tyr15] Fibrinopeptide B, human | Inquiry | ||
F02021 | V14 Peptide | Inquiry | ||
F02002 | Gamma-Fibrinogen (377-395), scrambled | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Figure 1. Chemical structure of lysipressinLysipressin ([Lys8]-vasopressin) has been identified in the North Ame ...
Proteolytic Processing of APP Following discovery of the full-length APP cDNA clone, numerous studies were undertaken to dete ...
of skin aging Skin aging is an obvious external manifestation of the natural process occurring in tissues and or ...
The factors of skin aging The skin is one of the largest organs of the body. In many cases, as the person's age changes, the ...
Afamelanotide, a drug for tanning skin, is a synthetic peptide and analogue of α-melanocyte stimulating hormone. ...