Home > Product > Catalog Peptides > Others > Fibronectin type-I 1

Others

Fibronectin type-I 1

[Price Inquiry]
CAT#
F04001
Sequence
PGCYDNGKHYQINQQWERTYLGNALVCTCYGGSRGFNCESK
Length
41
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.