Home > Product > Catalog Peptides > Others > Fibronectin type-I 2

Others

Fibronectin type-I 2

[Price Inquiry]
CAT#
F04002
Sequence
ETCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGAGRGRISCTIA
Length
44
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.