Home > Product > Catalog Peptides > Others > Fibronectin type-I 4

Others

Fibronectin type-I 4

[Price Inquiry]
CAT#
F04004
Sequence
EKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSR
Length
45
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.