Home > Product > Catalog Peptides > Others > Fibronectin type-I 6

Others

warning All products are for research use only. Not for human use.

Fibronectin type-I 6

[Price Inquiry]
CAT#
F04006
Sequence
GHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQET
Length
40
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.