Home > Product > Catalog Peptides > Others > Fibronectin type-II 1

Others

Fibronectin type-II 1

[Price Inquiry]
CAT#
M13009
Sequence
ADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPH
Modifications
Phosphotyrosine
Length
49
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.