Home > Product > Catalog Peptides > Others > Fibronectin type-II 2

Others

Fibronectin type-II 2

Price Inquiry
CAT#
M13010
Sequence
AEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPE
Modifications
Disulfide bond(2)
Length
49

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.