Home > Product > Catalog Peptides > Others > Fibronectin type-II 2

Others

Fibronectin type-II 2

[Price Inquiry]
CAT#
M13010
Sequence
AEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPE
Modifications
Disulfide bond(2)
Length
49
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.