Home > Product > Antimicrobial Peptides > Fowlicidin-2

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Fowlicidin-2

[Price Inquiry]
CAT#
AF2139
Sequence
LVQRGRFGRFLRKIRRFRPKVTITIQGSARFG
Host Chemicals
Gallus gallus
Length
32
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.