Home > Product > Antimicrobial Peptides > Gaegurin-6-RA peptide precursor

Antimicrobial Peptides

Gaegurin-6-RA peptide precursor

[Price Inquiry]
CAT#
AF3120
Sequence
TMKKSLLLIFFLGTINLSLCQEERNAEEEKRDGDDEMDAEVEKR
Host Chemicals
Odorrana andersonii (golden crossband frog)
Length
44
Activity
Antimicrobial
SwissProt ID
E3SYM7
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.