Home > Product > Antimicrobial Peptides > Gaegurin-6-RN antimicrobial peptide

Antimicrobial Peptides

Gaegurin-6-RN antimicrobial peptide

[Price Inquiry]
CAT#
AF3139
Sequence
FPMKKSLLLIFFLGTINLSFCEEERNAEEEKRDGDDEMDVEVQKR
Host Chemicals
Rana nigrovittata
Length
45
Activity
Antimicrobial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.