Home > Product > Antimicrobial Peptides > Gal 9

Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF2493
Sequence
DTLACRQSHGSCSFVACRAPSVDIGTCRGGKLKCCK
Host Chemicals
Gallus gallus
Length
36
Activity
Antimicrobial
SwissProt ID
Q6QLR1
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.