Home > Product > Catalog Peptides > Others > Galanin Like Peptide (GALP), rat

Others

Galanin Like Peptide (GALP), rat

[Price Inquiry]
CAT#
G01021
Sequence
APAHRGRGGWTLNSAGYLLGPVLHLSSKANQGRKTDSALEIL
M.W/Mr.
6502.4
Length
42
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.