Home > Product > Catalog Peptides > Others > Galanin, rat

Others

Galanin, rat

Price Inquiry
CAT#
G01015
Sequence
GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2
M.W/Mr.
3164.5
Molecular Formula
C141H211N43O41
Length
29

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.