Home > Product > Catalog Peptides > Others > Galanin, rat

Others

warning All products are for research use only. Not for human use.

Galanin, rat

[Price Inquiry]
CAT#
G01015
Sequence
GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2
M.W/Mr.
3164.5
Molecular Formula
C141H211N43O41
Length
29
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.