Home > Product > Antimicrobial Peptides > Galleria defensin

Antimicrobial Peptides

Galleria defensin

[Price Inquiry]
CAT#
AF2992
Sequence
DTLIGSCVWGATNYTSDCNAECKRRGYKGGHCGSFLNVNCWCE
Host Chemicals
Galleria mellonella
Length
43
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.