CAT# | AF2992 |
Sequence | DTLIGSCVWGATNYTSDCNAECKRRGYKGGHCGSFLNVNCWCE |
Activity | Antibacterial |
Host Chemicals | Galleria mellonella | Length | 43 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF1651 | Cysteine-rich antifungal protein 2 (Br-AFP2) | Inquiry | ||
AF1428 | Maximin 31 | Inquiry | ||
AF1717 | DMS2_PHYHZ Dermaseptin-H2 | Inquiry | ||
AF561 | Antimicrobial peptide , immobilized peptide E17KGG | Inquiry | ||
AF2635 | Lividin-4 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Zonisamide, sold as brand name Zonegran, is a derivative of 3-(sulfamoylmethyl)-l,2-benzisoxazole. It is a membe ...
Leuprolide acetate, an acetate salt with similar structure to luteinizing hormone-releasing hormone (LHRH) secre ...
KAI-1678, a synthetic 21-amino acid, is a novel PKC-epsilon (ε-PKC) inhibitor with a molecular weight of 2541 Da ...
JIP1, a member of the JIPs family, was first discovered to promote JNK activation by combining multiple componen ...
The mammalian precursor gene proglucagon, which contains the glucagon sequence together with two structurally related glucago ...