Home > Product > Antimicrobial Peptides > Gallerimycin

Antimicrobial Peptides

Gallerimycin

[Price Inquiry]
CAT#
AF2941
Sequence
GVTITVKPPFPGCVFYECIANCRSRGYKNGGYCTINGCQCLR
Host Chemicals
Galleria mellonella
Length
42
Activity
Antifungal
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.