Home > Product > Antimicrobial Peptides > Gallin

Antimicrobial Peptides

CAT#
AF2894
Sequence
LVLKYCPKIGYCSNTCSKTQIWATSHGCKMYCCLPASWKWK
Host Chemicals
Gallus gallus
Length
41
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.