Home > Product > Antimicrobial Peptides > Gallinacin 2, Gal-2

Antimicrobial Peptides

Gallinacin 2, Gal-2

[Price Inquiry]
CAT#
AF2509
Sequence
LFCKGGSCHFGGCPSHLIKVGSCFGFRSCCKWPWNA
Host Chemicals
Gallus gallus
Length
36
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.