Home > Product > Antimicrobial Peptides > Gallinacin-4

Antimicrobial Peptides

Gallinacin-4

[Price Inquiry]
CAT#
AF2747
Sequence
RYHMQCGYRGTFCTPGKCPHGNAYLGLCRPKYSCCRWL
Host Chemicals
Gallus gallus
Length
38
Activity
Antibacterial
SwissProt ID
Q6GXJ1
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.