Home > Product > Antimicrobial Peptides > Gallinacin-1

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Gallinacin-1

[Price Inquiry]
CAT#
AF2775
Sequence
GRKSDCFRKSGFCAFLKCPSLTLISGKCSRFYLCCKRIW
Host Chemicals
Gallus gallus
Length
39
Activity
Antibacterial, Antifungal
SwissProt ID
P46156
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.