Home > Product > Antimicrobial Peptides > Gallinacin 6

Antimicrobial Peptides

Gallinacin 6

[Price Inquiry]
CAT#
AF2871
Sequence
DTLACRQSHGSCSFVACRAPSVDIGTCRGGKLKCCKWAPSS
Host Chemicals
Gallus gallus
Length
41
Activity
Antibacterial, Antifungal
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.