Home > Product > Antimicrobial Peptides > Gallinacin-14

Antimicrobial Peptides

Gallinacin-14

[Price Inquiry]
CAT#
AF2876
Sequence
ESDTVTCRKMKGKCSFLLCPFFKRSSGTCYNGLAKCCRPFW
Host Chemicals
Gallus gallus
Length
41
Activity
Antibacterial
SwissProt ID
Q0E4V3
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.