Home > Product > Antimicrobial Peptides > Gallinacin-2 precursor

Antimicrobial Peptides

Gallinacin-2 precursor

[Price Inquiry]
CAT#
AF2405
Sequence
FCKGGSCHFGGCPSHLIKVGSCFGFRSCCKWPWNA
Host Chemicals
Gallus gallus
Length
35
Activity
Antibacterial, Antifungal
SwissProt ID
P46158
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.