Home > Product > Antimicrobial Peptides > Garvicin ML

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Garvicin ML

[Price Inquiry]
CAT#
AF3335
Sequence
LVATGMAAGVAKTIVNAVSAGMDIATALSLFSGAFTAAGGIMALIKKYAQKKLWKQLIAA
Host Chemicals
Lactococcus garvieae DCC43
Length
60
Activity
Gram+,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.