Home > Product > Antimicrobial Peptides > Garvieacin Q

Antimicrobial Peptides

Garvieacin Q

[Price Inquiry]
CAT#
AF3259
Sequence
EYHLMNGANGYLTRVNGKTVYRVTKDPVSAVFGVISNCWGSAGAGFGPQH
Host Chemicals
lactic acid bacteria, Lactococcus garvieae BCC 43578
Length
50
Activity
Gram+,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.