Home > Product > Antimicrobial Peptides > Gassericin A

Antimicrobial Peptides

Gassericin A

[Price Inquiry]
CAT#
AF3322
Sequence
IYWIADQFGIHLATGTARKLLDAMASGASLGTAFAAILGVTLPAWALAAAGALGATAA
Host Chemicals
Lactobacillus gasseri LA39; Lactobacillus reuteri LA6
Length
58
Activity
Gram+ & Gram-,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.