Home > Product > Catalog Peptides > Others > Gastric Inhibitory Peptide (1-39), human

Others

Gastric Inhibitory Peptide (1-39), human

[Price Inquiry]
CAT#
G02005
Sequence
YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDW
M.W/Mr.
4261.82
Molecular Formula
C195H287N49O57S1
Length
36
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.