Home > Product > Catalog Peptides > Others > Gastric Inhibitory Peptide (1-39), human

Others

Gastric Inhibitory Peptide (1-39), human

Price Inquiry
CAT#
G02005
Sequence
YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDW
M.W/Mr.
4261.82
Molecular Formula
C195H287N49O57S1
Length
36

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.