Home > Product > Antimicrobial Peptides > Gastric inhibitory polypeptide

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Gastric inhibitory polypeptide

[Price Inquiry]
CAT#
AF2506
Sequence
ISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ
Host Chemicals
Sus scrofa
Length
36
Activity
Antibacterial
SwissProt ID
P01281
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.