Home > Product > Catalog Peptides > Gastric Inhibitory Polypeptide and Fragments > Gastric inhibitory polypeptide

Gastric Inhibitory Polypeptide and Fragments

Gastric inhibitory polypeptide

Price Inquiry
CAT#
AF2506
Sequence
ISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ
Host Chemicals
Sus scrofa
Length
36
Activity
Antibacterial
SwissProt ID
P01281

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.