Home > Product > Catalog Peptides > Others > Gastric Inhibitory Polypeptide (1-30), porcine

Others

warning All products are for research use only. Not for human use.

Gastric Inhibitory Polypeptide (1-30), porcine

[Price Inquiry]
CAT#
G02004
Sequence
YAEGTFISDYSIAMDKIRQQDFVNWLLAQK
M.W/Mr.
3552.1
Molecular Formula
C162H244N40O48S1
Length
30
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.