Home > Product > Catalog Peptides > Gastric Inhibitory Polypeptide and Fragments > Gastric Inhibitory Polypeptide (1-30), porcine

Gastric Inhibitory Polypeptide and Fragments

Gastric Inhibitory Polypeptide (1-30), porcine

Price Inquiry
CAT#
G02004
Sequence
YAEGTFISDYSIAMDKIRQQDFVNWLLAQK
M.W/Mr.
3552.1
Molecular Formula
C162H244N40O48S1
Length
30

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.