Home > Product > Catalog Peptides > Others > Gastrin Releasing Peptide, human

Others

Gastrin Releasing Peptide, human

[Price Inquiry]
CAT#
G03016
Sequence
VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
M.W/Mr.
2859.3
Molecular Formula
C130H204N38O31S2
Length
27
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.