Home > Product > Antimicrobial Peptides > GcLEAP-2

Antimicrobial Peptides

CAT#
AF2895
Sequence
MTPLWRIMGTKPHGAYCQNHYECSTGICRKGHCSYSQPINS
Host Chemicals
Ctenopharyngodon idella
Length
41
Activity
Antimicrobial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.