Home > Product > Catalog Peptides > Others > GIP (3-42), human

Others

GIP (3-42), human

Price Inquiry
CAT#
G02006
Sequence
EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
M.W/Mr.
4759.4
Length
40

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.