Home > Product > Catalog Peptides > Others > GIP (3-42), human

Others

warning All products are for research use only. Not for human use.

GIP (3-42), human

[Price Inquiry]
CAT#
G02006
Sequence
EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
M.W/Mr.
4759.4
Length
40
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.