Home > Product > Catalog Peptides > Others > GIP, mouse, rat

Others

GIP, mouse, rat

[Price Inquiry]
CAT#
G02010
Sequence
YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNITQ
M.W/Mr.
5002.7
Length
42
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.