Home > Product > Catalog Peptides > Others > GIP (1 - 30), porcine, amide

Others

GIP (1 - 30), porcine, amide

Price Inquiry
CAT#
G02003
Sequence
YAEGTFISDYSIAMDKIRQQDFVNWLLAQK-NH2
M.W/Mr.
3551
Length
30

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.