Home > Product > Catalog Peptides > Others > GIP (1 - 30), porcine, amide

Others

GIP (1 - 30), porcine, amide

[Price Inquiry]
CAT#
G02003
Sequence
YAEGTFISDYSIAMDKIRQQDFVNWLLAQK-NH2
M.W/Mr.
3551
Length
30
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.