Home > Product > Catalog Peptides > Others > GIP, porcine

Others

GIP, porcine

[Price Inquiry]
CAT#
G02008
Sequence
YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ
M.W/Mr.
4975.6
Length
42
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.