Home > Product > Catalog Peptides > β-Amyloid Mutations > [Gln22]-beta-Amyloid (1-42), E22Q Dutch Mutation

β-Amyloid Mutations

warning All products are for research use only. Not for human use.

[Gln22]-beta-Amyloid (1-42), E22Q Dutch Mutation

[Price Inquiry]
CAT#
A13304
Sequence
DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVVIA
M.W/Mr.
4513.1
Length
42
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.