Home > Product > Catalog Peptides > Others > GLP-1 (7-36), amide, chicken, common turkey

Others

warning All products are for research use only. Not for human use.

GLP-1 (7-36), amide, chicken, common turkey

[Price Inquiry]
CAT#
G16004
Sequence
AEGTYTSDITSYLEGQAAKEFIAWLVNGR-NH2
M.W/Mr.
3327.7
Molecular Formula
C149H224N40O47
Length
29
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.