Home > Product > Catalog Peptides > Others > GLP-1/Glucagon-Like Peptide, amide, human

Others

warning All products are for research use only. Not for human use.

GLP-1/Glucagon-Like Peptide, amide, human

[Price Inquiry]
CAT#
G16009
Sequence
DEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
M.W/Mr.
4111.5
Molecular Formula
C184H273N51O57
Length
35
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.