Home > Product > Catalog Peptides > Glucagons and Glucagon-Like Peptides (GLP-1 / GLP-2) > GLP - 2 (1 - 34), Glucagon - Like Peptide - 2 (1 - 34), human

Glucagons and Glucagon-Like Peptides (GLP-1 / GLP-2)

GLP - 2 (1 - 34), Glucagon - Like Peptide - 2 (1 - 34), human

[Price Inquiry]
CAT#
G16008
Sequence
HADGSFSDEMNTILDNLAARDFINWLIQTKITDR
M.W/Mr.
3922.4
Length
34
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.