Home > Product > Catalog Peptides > Others > GLP - 2 (1 - 34), Glucagon - Like Peptide - 2 (1 - 34), human

Others

warning All products are for research use only. Not for human use.

GLP - 2 (1 - 34), Glucagon - Like Peptide - 2 (1 - 34), human

[Price Inquiry]
CAT#
G16008
Sequence
HADGSFSDEMNTILDNLAARDFINWLIQTKITDR
M.W/Mr.
3922.4
Length
34
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.