Home > Product > Catalog Peptides > Glucagons and Glucagon-Like Peptides (GLP-1 / GLP-2) > GLP-1/Glucagon-Like Peptide, human

Glucagons and Glucagon-Like Peptides (GLP-1 / GLP-2)

GLP-1/Glucagon-Like Peptide, human

[Price Inquiry]
CAT#
G16010
Sequence
DEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
M.W/Mr.
4169.6
Molecular Formula
C186H275N51O59
Length
36
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.